PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco006017.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family MIKC_MADS
Protein Properties Length: 197aa    MW: 22878.2 Da    PI: 8.2291
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco006017.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF73.91.3e-23957149
                 S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
       SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                 krien ++rq tf kRr g++KKA ELS+LCda+ ++++fss+gkly +
  Aco006017.1  9 KRIENPTQRQSTFYKRRDGLFKKARELSILCDADLLLLLFSSSGKLYHF 57
                 79*********************************************99 PP

2K-box393.4e-1472170199
        K-box   1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                  y+ +++++ ++  + + + e++k+++  e +++e+R ++ +d e  +l  L  Le++Le +++k+Rs K++ +  +i+ l ++ ++ qee   L++kl
  Aco006017.1  72 YEMATNTKIWKDYHLERDAEIEKVQNLCELMEKELRFMKVDDREHYTLPTLDMLEHNLEAAISKVRSEKERKMGGEINFLENMVRDKQEERFGLSEKL 169
                  566788889**************************************************************************************998 PP

        K-box  99 e 99 
                  +
  Aco006017.1 170 A 170
                  6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.8E-33160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006629.03161IPR002100Transcription factor, MADS-box
SuperFamilySSF554555.1E-29290IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-23323IPR002100Transcription factor, MADS-box
PfamPF003193.3E-231057IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-232338IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-233859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129710.20885175IPR002487Transcription factor, K-box
PfamPF014863.0E-1188169IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 197 aa     Download sequence    Send to blast
MGRGRTEIKR IENPTQRQST FYKRRDGLFK KARELSILCD ADLLLLLFSS SGKLYHFHAP  60
SVPSVKDFIE RYEMATNTKI WKDYHLERDA EIEKVQNLCE LMEKELRFMK VDDREHYTLP  120
TLDMLEHNLE AAISKVRSEK ERKMGGEINF LENMVRDKQE ERFGLSEKLA QVQTLKNMGG  180
GSTSFSHGLD LKLGFN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P9e-14180184Myocyte-specific enhancer factor 2B
1tqe_Q9e-14180184Myocyte-specific enhancer factor 2B
1tqe_R9e-14180184Myocyte-specific enhancer factor 2B
1tqe_S9e-14180184Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006644649.11e-102PREDICTED: MADS-box transcription factor 32 isoform X1
SwissprotQ8S1511e-103MAD32_ORYSJ; MADS-box transcription factor 32
TrEMBLJ3L3N91e-102J3L3N9_ORYBR; Uncharacterized protein
STRINGOB01G38450.11e-101(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP119233439
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G20240.15e-18MIKC_MADS family protein